Abstract
Shigellosis remains a major global health concern, particularly in regions with poor sanitation and limited access to clean water. This study used immunoinformatics and reverse vaccinology to design a potential mRNA vaccine targeting Shigella pathotypes out of 4071 proteins from Shigella sonnei str. Ss046, 4 key antigenic candidates were identified: putative outer membrane protein (Q3YZL0), PapC-like porin protein (Q3YZM5), putative fimbrial-like protein (Q3Z3I2), and lipopolysaccharide (LPS)-assembly protein LptD (Q3Z5V5), ensuring broad pathotype coverage. A multitope vaccine was designed incorporating cytotoxic T lymphocyte, helper T lymphocyte, and B-cell epitopes, linked with suitable linkers and adjuvants to enhance immunogenicity. Computational analyses predicted vaccine’s favorable antigenicity, solubility, and stability, while molecular docking and dynamic simulations demonstrated strong binding affinity and stability with Toll-like receptor 4 (TLR-4), indicating potential for robust immune activation. Immune simulations predicted strong humoral and cellular immune responses, characterized by significant cytokine production and long-term immune memory. Structural evaluations of the complex, including radius of gyration, root mean square deviation, root mean square fluctuation, and solvent accessibility, confirmed the vaccine’s structural integrity, and stability under physiological conditions. This research contributes to the ongoing effort to alleviate the global burden of Shigella infections, providing a foundation for future wet laboratory investigations aimed at vaccine development.
Introduction
Bacillary dysentery, caused by the gram-negative bacterium Shigella, is a potentially fatal type of diarrhea that may induce severe dehydration. 1 Shigella dysenteriae, S. flexneri, S. boydii, and S. sonnei are the 4 most common pathotypes, and they all have unique serotypes and antigenic profiles responsible for disease causation. 2 Infections caused by S. dysenteriae and S. boydii are uncommon in most parts of the globe. Sub-Saharan Africa and South Asia are common regions for isolating S. dysenteriae, whereas the Indian subcontinent is the most common region for isolating S. boydii. 3 S. sonnei accounts for up to 80% of cases of shigellosis in developed countries, 4 but it has recently surpassed S. flexneri as the most common infectious species in low-income countries with poor access to water, sanitation, and health care.5,6 The reason behind the historical presence of S. sonnei in high-income nations and its recent emergence in low-income countries remains unclear. 7 One possible explanation is natural passive immunization through Plesiomonas shigelloides, a bacterium that shares an identical lipopolysaccharide (LPS) O-side chain, which previously conferred protection against S. sonnei. 7 However, as economic conditions improve, this protective effect may diminish, contributing to the rising incidence of shigellosis. 8 S. flexneri instances have decreased while S. sonnei cases have increased, mostly in quickly growing nations in Asia, Latin America, and the Middle East.7,9-13 Because of its remarkable adaptability and arsenal of antibiotic-resistance genes, 14 S. sonnei has also emerged as a major public health danger in recent years. Worldwide, there are an estimated 164.7 million cases of Shigella infection each year, with an estimated 1.1 million fatalities, most of them occurring in children less than 5 years old.15,16 Approximately 1.5 million new cases of shigellosis occur annually in industrialized nations, with the United States accounting for about a quarter of these cases. S. sonnei is the predominant strain in the United States, responsible for 77% of all reported infections. 1 Noteworthy vulnerable populations include children, the elderly, and individuals with compromised immune systems. 17 Travelers visiting impoverished nations, members of the armed forces, refugees, and people in institutional settings are also at risk for contracting shigellosis.18-20 This widespread infection rate is a major contributor to both the global public health concern and the global economic disruption that follows.7,9,10,15 Antibiotic resistance and a dearth of effective vaccinations have severely constrained existing methods of treating S. infection. 21 In response, considerable research efforts have focused on vaccine development, exploring various strategies such as killed whole-cell vaccines, live-attenuated vaccines, subunit vaccines, conjugate vaccines, outer membrane vesicle (OMV) vaccines, and more recently, mRNA vaccines. 22 Despite the advancement of several candidates to clinical trials, including Phase 3, no vaccine has been licensed to date. 23 Challenges in achieving broad, long-lasting protection across diverse Shigella serotypes have hampered progress.23,24 ZF0901 (Beijing Zhifei Lvzhu Biopharmaceuticals) is a bivalent glycoconjugate vaccine targeting S. sonnei and S. flexneri 2a, currently in Phase 3 trials. 25 S4V2 (Valneva SE and LimmaTech) is a tetravalent bioconjugate vaccine targeting S. flexneri 2a, 3a, 6, and S. sonnei, undergoing Phase 2 trials in LMICs and a Phase 2b controlled human infection model (CHIM) study in the United States, with Fast Track designation from the U.S. FDA (NCT06615375). Invaplex AR-Detox (WRAIR), a subunit vaccine combining Shigella LPS with Ipa proteins, has shown good safety and immunogenicity in Phase 1 trials. 26 SF2a-TT15 (Institut Pasteur), a synthetic glycoconjugate vaccine targeting S. flexneri 2a, has demonstrated strong antibody responses in Phase 1 trials. 27
Given the pressing need for an effective and broadly protective Shigella vaccine, we have employed a computational approach to design a multitope mRNA vaccine targeting the most prevalent Shigella pathotypes. Using their ability to attach to major histocompatibility complex (MHC) molecules on antigen-presenting cells and T-cell receptors on T-cells, small peptides (epitopes) may activate unique immune responses. 28 Many novel methods such as peptide-based and DNA vaccines showed promising opportunities for developing scalable and rapid vaccines. Advances in immunoinformatics have facilitated the development of peptide-based vaccines, which offer advantages such as minimal toxicity, ease of production, and broad antigenic coverage. 29 Other bacterial and viral diseases, including Escherichia coli,30,31 Mycobacterium tuberculosis, 32 Streptococcus pneumoniae, 33 hepatitis C virus (HCV), 34 severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), 35 human immunodeficiency virus (HIV), 36 and Influenza virus subtypes, 37 have all benefited from epitope-based vaccinations. However, despite the promise of peptide-based vaccines, their immunogenicity index was observed to be low. 38 In addition, the use of pDNA within DNA vaccines raised concerns regarding the risk of insertional mutagenesis. 39 In contrast, mRNA vaccines have emerged as a more promising alternative, demonstrating higher efficacy compared to DNA vaccines. This is attributed to the potential of mRNA vaccines to mitigate safety concerns while enhancing efficacy. Notably, mRNA therapeutics are considered noninfectious entities due to their lack of genomic integration and replication, with rare exceptions of recombination between single-stranded RNA molecules. 40 Since S. sonnei str. Ss046 is the Uniprot reference strain for S. sonnei, 41 we were motivated to adopt a reverse vaccinology technique to find prospective vaccine candidates from its proteome. The exoproteome and secretome were predicted using a suite of bioinformatics algorithms and filters, 42 including those for predicting virulence factors, human homologs, molecular weight, transmembrane helices, antigenicity, conservancy, and population coverage.43-49 We used immunoinformatics methods to choose 4 proteins that fulfilled all the requirements and to estimate their T-cell and B-cell epitopes.48,50 By fusing the chosen epitopes with the proper linkers and adjuvants, we were able to create a multitope vaccine. The designed vaccine’s physicochemical properties, solubility, secondary, and tertiary structures, conformational B-cell epitopes, disulfide bonds, docking with toll-like receptor 4 (TLR-4), normal mode analysis, and immune simulation were all analyzed.51-59 So, the overall aim of this study is to provide a safer, more efficient, and broader coverage solution against various Shigella strains by in silico approaches, addressing the limitations of current treatment methods.
Materials and Methods
Retrieval of protein sequence
We obtained the amino acid sequences of S. sonnei str. Ss046’s complete proteome from UniProt, using Taxon ID 300269 and entry ID UP000002529, where this strain serves as the reference proteome. 41 Given its significant impact as a predominant pathogen, S. sonnei was selected as our primary focus.11,16 Notably, S. sonnei is believed to have evolved more recently compared to other Shigella species and serotypes, and it frequently emerges in low-income countries transitioning from developing to developed status, thus altering the global epidemiological landscape. 60 Its tendency to appear in low-income countries that are emerging from the ranks of the developed has also altered the global epidemiological landscape. 9 Figure 1 depicts the whole study design.

A methodological flow diagram of in silico vaccine design against common Shigella pathotypes. Light blue shapes represent ss046’s sequence retrieval, analysis, epitope prediction, structural evaluation and yellow boxes showing mRNA vaccine construct, whereas magenta shapes represent simulation tests, respectively.
Prediction of exoproteome, secretome, and their essentiality
Using the entire proteome of S. sonnei str. Ss046, we employed PSORTb v3.0.2 online server 42 (https://www.psort.org/psortb/) and Geptop 2.0 61 (http://geptop.molgenrug.nl/) to predict the subcellular localization of 4071 proteins. A standard essentiality score threshold of 0.24 was applied. To identify potential vaccination candidates, we focused on proteins predicted to localize in the outer membrane or extracellular space, encompassing both essential and nonessential proteins within these compartments.
Prediction of virulent proteins and transmembrane helices
VirulenPred 43 (http://crdd.osdd.net/raghava/virulenpred/) was used to evaluate the exoproteome and secretome for virulence. We were careful to choose just potentially harmful proteins. In addition, we only chose proteins that included at least one predicted transmembrane helix using TMHMM 46 (http://www.cbs.dtu.dk/services/TMHMM/).
Determination of human homologs and molecular weight estimation
To see whether any of the virulence proteins have human homologs, we ran a BLASTp 44 search (https://blast.ncbi.nlm.nih.gov/Blast.cgi) against the human proteome. Any protein similar to a human protein (35%) was ruled out. Using the Expasy tool (https://web.expasy.org/compute_pi/), 45 we assessed the molecular weight of the remaining proteins and chose only those with molecular weights of less than 110 kDa.
Protein antigenicity, maturation, and conservation analysis with various Shigella pathotypes
We assessed the antigenicity of proteins using Vaxijen V 2.049 47 (http://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.html), categorizing those with antigenicity values higher than 0.4. Eleven Shigella strains, covering a range of pathologies, were analyzed for their degree of conservation of the proteins specified in the previous rounds. One main goal of this research was to ensure that the developed vaccine will be effective against all pathogenic Shigella by doing BLASTp analysis on each protein against a representative strain of each pathotype. Any protein that had a sharing percentage of less than 80% was either removed or suggested for elimination. We used SignalP 5.0 62 Server (http://www.cbs.dtu.dk/services/SignalP/) to estimate the site of the signal peptide, based on the filtered proteins. The full-grown peptides were collected for future study.
Screening for B- and T-cell epitopes
Epitopes for both cytotoxic T lymphocytes (CTLs) and helper T lymphocytes (HTLs) were predicted using the immune epitope database (IEDB) website 63 (http://www.iedb.org/). We predicted epitopes recognized by CTLs that were shared by the HLA allele reference set that covered more than 97% of the population. Antigenicity, allergenicity, toxicity, conservancy, immunogenicity, and population coverage were determined by profiling the top 100 peptides. We employed the IEDB server’s conservancy tool (http://tools.iedb.org/conservancy), immunogenicity tool (http://tools.iedb.org/immunogenicity), and population coverage tool (http://tools.iedb.org/population). Antigenicity, toxicity, and allergenicity predictions were made using the VaxiJen (http://www.ddgpharmfac.net/vaxijen/VaxiJen/VaxiJen.html), ToxinPred2, and AllerTOP v.2.0 (https://www.ddg-pharmfac.net/AllerTOP/index.html) software packages. Based on the lowest percentile rank, maximum antigenicity, immunogenicity, and binding affinity, we picked the top 10 peptides that fulfilled all criteria. HTL epitope predictions were made using an HLA allele reference collection with above 99% population coverage. Antigenicity, allergenicity, toxicity, conservancy, induction of interferon-gamma (IFN-γ), interleukin-4 (IL-4), and interleukin-10 (IL-10) as well as population coverage criteria were used to identify the top 100 peptides for profiling. Online resources such as IFNepitope (https://webs.iiitd.edu.in/raghava/ifnepitope/predict.php), IL4pred (https://webs.iiitd.edu.in/raghava/il4pred/index.php), and IL-10Pred (https://webs.iiitd.edu.in/raghava/il10pred/predict) were used for cytokine prediction. The peptides with the greatest antigenicity binding affinity and the lowest percentile rank were chosen as the top 10. We also used docking research using Autodock Vina 64 (https://vina.scripps.edu/) to evaluate the binding affinity of the potential CTLs and HTLs with their corresponding HLA alleles. To do this, the PEP FOLD 3 webserver 65 was used to predict the 3D structure of each peptide. Concurrently, the 3-dimensional structures of HLA-A02:01 (PDB ID 4u6y) and HLA-DRB104:01 (PDB ID 5lax) were obtained from the protein data bank to serve as receptors for MHC-I and MHC-II epitopes, respectively. Linear B-cell epitopes were predicted using the IEDB server’s (http://www.iedb.org/) Bepipred Linear Epitope Prediction 2.0, Emini Surface Accessibility Prediction, and Kolaskar and Tongaonkar Antigenicity tools. Antigenicity ratings greater than 0.4 were used to identify peptides with a length between 8 and 20 amino acids. We tested the selected peptides for toxicity and allergenicity using the same servers as previously for single epitope estimation.
Homology modeling and epitope mapping
The 3D structures of the 4 target proteins were modeled using SWISS-MODEL. The highest-quality templates were selected based on sequence identity (>80%), and GMQE (>.50). Structural validation was performed using PROCHECK (Ramachandran plot analysis). After validation, epitope regions were mapped onto the surface of the modeled proteins. PyMOL and Discovery Studio were used to visualize the predicted epitopes, allowing assessment of their spatial distribution, surface accessibility, and potential immunogenic properties. Selected epitopes (CTL, HTL, and B-cell) were color-coded to visualize their locations on each protein.
Design and construction of multi-epitope vaccine candidate
We used GGGS, GPGPG, and KK amino acid linkers to join the top 24 CTL, HTL, and B-cell epitope candidates from the epitope prediction stage to create a possible multitope vaccination. To complete the constructed vaccine, we included the PADRE sequence and defensin adjuvant in addition to the epitopes. Using the same servers as before for single epitope estimate, we analyzed the vaccine candidate’s antigenicity score, 47 allergenicity, 66 and toxicity probability. 67 We analyzed the physicochemical characteristics of the proposed vaccination using the ProtParam program, which can be found on the Expasy server 45 (https://web.expasy.org/protparam/).
Secondary and tertiary structure of the SS-Ss046
We used the SOLpro server 51 (http://scratch.proteomics.ics.uci.edu/) and the PSIPRED 4.0 webserver 68 (http://bioinf.cs.ucl.ac.uk/psipred/) to make predictions about the likelihood of overexpression in E coli and the protein secondary structure of the multitype construct, respectively. To evaluate the prospective vaccine’s interaction with a TLR, we predicted its 3D structure. To do this, we accessed the 3Dpro 69 (http://www.sbg.bio.ic.ac.uk/3dpro/) and Phyle2 webserver 70 (http://www.sbg.bio.ic.ac.uk/phyre2/html/page.cgi?id=index). After predicting the tertiary structure, we enhanced its stability and energy using the GalaxyRefine server 71 (http://galaxy.seoklab.org/cgi-bin/submit.cgi?type=REFINE), followed by validation through Ramachandran plot analysis 71 and ProSA 72 (https://prosa.services.came.sbg.ac.at/prosa.php).
Prediction of conformational B-cell epitopes
After performing 3D structure prediction and refinement, we made predictions about the conformational B-cell epitopes that would be used in the multitope design. For this prediction, we used ElliPro Server 54 (http://tools.iedb.org/ellipro/), a trustworthy program for identifying B-cell epitopes against a given antigen. A minimum score threshold of 0.5 and maximum distance of 6 angstrom was applied to ensure epitope reliability. ElliPro approximates protein shape using ellipsoids, with higher PI values indicating greater solvent accessibility.
Disulfide engineering of the designed vaccine
We included disulfide links to strengthen the 3D structure of the planned construct before beginning docking research for the created potential vaccine. Disulfide linkages are thought to increase protein stability by altering the protein’s geometric shape. For this, our team turned to Disulfide by Design 2.0 55 (http://cptweb.cpt.wayne.edu/dbd2/).
Docking of designed vaccine with hTLR-4
For our epitope-based synthetic vaccine design, we selected hTLR-4 (PDB ID: 4G8A) as the target receptor. Docking analysis between the ligand and receptor was performed using the ClusPro 2.0 server 57 (https://cluspro.org/). By running billions of conformations, aggregating the 1000 lowest energy structures created, and filtering out steric conflicts, this service can accurately predict the optimum docking models. The ligand and receptor PDB files were uploaded to the ClusPro service, and docking was conducted using the default settings.
Dihedral coordinate-based normal-mode analyses
To learn more about how the built epitope vaccine moves with respect to the bound hTLR-4 protein target, we used the iMODS server 58 (http://www.imods.chaconlab.org/). This server’s speed and effectiveness are definite pluses. A high eigenvalue, for example, indicates a more severe deformation as predicted by this service.
Immune simulation of the designed vaccine
Using a computational method, we predicted the stimulated immune response to the proposed vaccination using the C-ImmSim server 73 (http://www.iac.rm.cnr.it/filippo/C-IMMSIM/). For this study, we injected the planned vaccine 3 times, each time waiting 4 weeks between doses, following the prime-booster-boost strategy. This strategy was used to induce a persistent immunological response.
Molecular dynamic simulation
A 100 ns Molecular dynamics (MD) simulation was carried out using the GROningen Machine for Chemical Simulations aka GROMACS. 56 The CHARMM36m force field was used for the simulation. Using the TIP3P water model, a water box was constructed with its borders 1 nm from the protein surface. The appropriate ions were used to neutralize the systems. The simulation was performed using periodic boundary conditions and a temporal integration step of 2 fs after energy minimization, isothermal-isochoric (NVT), and Isobaric (NPT) equilibration of the system. For this trajectory analysis, a 100 ps snapshot interval was used. Root mean square deviation (RMSD), root mean square fluctuation (RMSF), radius of gyration (Rg), and solvent accessible surface area (SASA) were calculated after the simulation was finished using the rms, rmsf, gyrate, and sasa modules included into the GROMACS program. As for the plots, they were all made using the ggplot2 tool in RStudio. All MD simulations were performed on high-performance simulation equipment at the Bioinformatics Division, National Institute of Biotechnology, using the Ubuntu 20.04.4 LTS operating system.
Codon-optimization and analysis of the vaccine mRNA
The Java Codon Adaptation Tool (JCat) server (http://www.prodoric.de/JCat) was used to measure the multi-epitope vaccine expression level in E coli (strain K12). To ensure maximal expression, Jcat computed the query sequence’s GC content and Codon Adaptation Index (CAI).
The secondary structure of mRNA was then predicted using the RNAfold web server (http://rna.tbi.univie.ac.at/cgi-bin/RNAWebSuite/RNAfold.cgi). This service forecasts the minimal free energy (MFE) and partition function created thermodynamically by the query mRNA structures. To analyze mRNA folding and vaccine secondary structure, the optimized DNA sequence was transformed to a possible RNA sequence using DNA <-> RNA-> Protein (http://biomodel.uah.es/en/lab/cybertory/analysis/trans.htm).
Result
Proteome analysis for selection of vaccine candidates
Among S. sonnei str. Ss046’s total of 4071 proteins, 140 proteins were predicted to be located in the outer membrane or extracellular space from which 81 were projected to be pathogenic. We used further criteria to pick the top 4 proteins that were not similar to proteins in humans, had high antigenicity scores and conserved among 11 Shigella strains representing different pathotypes (Supplemental S1 Figure). Q3YZL0 was a putative outer membrane protein, Q3YZM5 was a PapC-like porin protein, Q3Z3I2 was a putative fimbrial-like protein, and Q3Z5V5 was the LPS-assembly protein LptD. Supplemental Tables S1 and S2 detail the protein properties and conservancy, respectively.
Prediction of T-cell and B-cell epitopes from the selected vaccine candidates
We used IEBD to generate peptides from the selected vaccine candidates followed by a comprehensive evaluation of their immunological properties. The top 100 generated MHC-1 peptides from IEBD per each protein candidate were estimated for their antigenicity score, allergenicity, toxicity probabilities, conservancy, immunogenicity, binding affinity, and population coverage. Out of the 400 candidates screened, peptides that passed the selection process were shown to be antigenic, with top scores ranging from 1.3031 to 0.4210. Notably, all peptides were predicted to be probable nonallergens and nontoxic, indicating their safety profile for potential vaccine development. Furthermore, these peptides exhibited the lowest percentile rank, ranging from 0.01 to 0.41, suggesting their uniqueness and potential efficacy in eliciting an immune response. Among the selected peptides, some demonstrated exceptionally high immunogenicity scores. The highest immunogenicity score recorded was 0.37078, with binding affinities ranging from −9.7 to −8.6 kcal/mol. In addition, all peptides exhibited complete conservancy, with a 100% conservancy score. This implies that the selected epitopes are highly conserved across different variants or strains of the corresponding proteins. These top-ranked epitopes (MHC-1 peptides) of each protein are listed in Table 1.
Characteristics of top-ranked linear MHC-1 epitopes on protein surface, predicted through ElliPro in IEDB-analysis resource from 4 selected vaccine candidates.
Here, PR = Percentile Rank, AS = Antigenicity Score, Conserv. = conservancy, Im = Immunogenicity.
The binding affinity of the selected CTL candidates was evaluated through a docking study, with the resulting docked complexes illustrated in Supplemental Figure S2 and the corresponding binding scores presented in Supplemental Table S3. Subsequently, the top 100 generated MHC-2 peptides from IEBD per each protein candidate were thoroughly evaluated for their antigenicity score, allergenicity, toxicity probabilities, binding affinity, and population coverage as well as the ability to induce IFN-γ, IL-4, and IL-10. From a pool of 400 promising candidates, we identified peptides that surpassed our stringent selection process. These peptides demonstrated high antigenicity scores ranging from 1.3408 to 0.4656 and were predicted to be non-allergenic and non-toxic, reinforcing their suitability for vaccine development. We found that the top-ranked peptides had the lowest percentile ranks, ranging from 0.15 to 5.1. In addition, they displayed an exceptional binding affinity ranging from −9.1 to −7 (kcal/mol), signifying strong interactions with the target MHC-2 molecules. Moreover, we assessed the ability of the epitopes to induce specific cytokine responses. Cytokines, such as IL-4, IFN-γ, and IL-10, play crucial roles in modulating the immune response. Epitopes capable of eliciting positive cytokine responses were considered favorable for their potential to induce robust and targeted immune reactions. For a detailed overview, we have listed the top-ranked epitopes (MHC-2 peptides) of each protein in Table 2.
Characteristics of top-ranked linear MHC -2 epitopes on protein surface, predicted through ElliPro in IEDB-analysis resource from 4 selected vaccine candidates.
Here, NON = Absent, PR = Percentile Rank, AS = Antigenicity Score, Tox = Toxicity Negative (−) = Absent, Positive (+) = Present.
The binding affinity of the selected HTL candidates was also analyzed, with the docked complexes displayed in Supplemental Figure S3 and their binding scores listed in Supplemental Table S3.
Docking validation for epitopes and MHC molecules
Two control peptides are known to bind with high affinity to the HLA-A*02:01 and DRB-1*04:01 alleles, respectively, and were used to verify the docking simulations. The peptide TSKGLFRAAVPSGAS (alpha-enolase peptide 26-40) 74 and NLVPMVATV (derived from cytomegalovirus protein pp65) 75 served as a positive control in our docking investigation for MHC-I and MHC-II binding, respectively. The docking scores for the MHC-I control peptide were recorded at −8.9 kcal/mol, while the MHC-II control peptide yielded a score of −7.5 kcal/mol.
In comparison, the selected vaccine candidate epitopes exhibited binding energy scores ranging from −8.6 to −9.7 kcal/mol for MHC-I interactions and from −7.0 to −9.1 kcal/mol for MHC-II interactions (Supplemental Table S3), indicating stronger or comparable binding affinities relative to the control peptides. By doing numerous independent dockings with various random seeds, we confirmed that the predicted binding affinities are not skewed by the random source used in the prediction process.
Population coverage of the predicted epitopes
We calculated the population coverage of the predicted epitopes using the IEDB tool. The combined CTL epitopes covered 98.55% of the world population, while the combined HTL epitopes were predicted to cover 99.88% of the global population. The multitope vaccine composed of all the selected epitopes covered 100% of the world population (Figure 2). Further regional-specific population coverage details are elaborated in the Supplemental Table S4, while the Global HLA Allele Reactivity Profiles for Selected Peptides including Coverage and Compatibility Analysis are detailed in the Supplemental Table S5.

World population coverage of the multitope vaccine composed of all the selected epitopes, showing 100% coverage of the world population. The x-axis indicates the Number of epitope hits/HLA combinations recognized and the y-axis (on the left) shows the Percentage of individuals that can recognize vaccine epitopes. The y-axis on the right shows how many pairs can be recognized by the world population. The blue line displays the total number of pairs, whereas the green line displays the percentage of pairs that are recognized. The ideal situation is depicted by the red line, in which everyone can use at least one vaccination epitope to combat pathogens.
Screening for B-cell epitopes
Bepipred Linear Epitope Prediction 2.0, Emini Surface Accessibility Prediction, and Kolaskar and Tongaonkar Antigenicity prediction tools were used for B-cell epitope identification. We identified 13 B-cell epitopes for Q3YZL0_outer membrane protein, 88 for Q3YZM5_PapC-like porin protein, 14 for Q3Z3I2_fimbrial-like protein, and 74 for Q3Z5V5_LPTD. Among the generated peptides for each protein, epitopes with a length between 8:20 amino acids were analyzed for their antigenicity, and peptides with antigenicity score >0.4 were tested for their allergenicity and toxicity. A list of predicted top B-cell epitopes of each protein and their characteristics are given in Table 3.
Properties of highly ranked linear B-cell epitopes on protein surface predicted using ElliPro in IEDB-analysis resource for 4 chosen vaccine candidates.
Homology modeling and epitope mapping
High-confidence 3D models were successfully generated for all target proteins, with validation metrics confirming their structural reliability. The Ramachandran plot analysis revealed that 100% of residues in the putative outer membrane protein (Q3YZL0) model, 99.5% in the PapC-like porin protein (Q3YZM5) model, 98.2% in the putative fimbrial-like protein (Q3Z3I2) model, and 99.7% in the LPS-assembly protein LptD (Q3Z5V5) model were in the favored regions. GMQE scores for the models ranged from 0.58 to 0.88, further supporting their structural accuracy and confidence for downstream analysis.
Molecular visualization of the mapped epitopes revealed their accessibility and immunological relevance. In the putative outer membrane protein (Q3YZL0), epitopes were found to be surface-exposed and readily accessible for immune recognition (Figure 3A). The PapC-like porin protein (Q3YZM5) exhibited epitope regions strategically positioned near porin channel openings, enhancing their potential for immune interaction (Figure 3B). The putative fimbrial-like protein (Q3Z3I2) displayed epitopes distributed across functionally significant domains (Figure 3C), while the LPS-assembly protein LptD (Q3Z5V5) demonstrated epitopes localized to extracellular and solvent-accessible regions (Figure 3D).

Structural visualization of the modeled target proteins with mapped epitope regions highlighted in yellow: (A) Putative outer membrane protein (Q3YZL0) showing surface-exposed and accessible epitope regions. (B) PapC-like porin protein (Q3YZM5) with epitope regions located near porin channel openings. (C) Putative fimbrial-like protein (Q3Z3I2) displaying epitopes distributed across functional domains. (D) LPS-assembly protein LptD (Q3Z5V5) with epitopes positioned in extracellular and solvent-accessible regions.
Multitope vaccine construction
We chose 8 epitopes per table of 1, 2, and 3 (2 epitopes from each protein candidate) and the sum of which is 24 candidates of CTL, HTL, and B-cell epitopes joined using GGGS, GPGPG, and KK as linkers. β-defensin and PADRE peptide were also incorporated using EAAK linker to finalize a potential vaccine sequence of 490 amino acids in length (Figure 4) and its sequence was as follows:
“EAAAKGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKKEAAAKAKFVAAWTLKAAAEAAAKAKFVAAWTLKAAAGGGSSGTDSSQVGYGGGSNSFRVSYSKGGGSVTKNATFTFGGGSTVTFKVDYIGGGSSVMAGPSVRVGGGSSEHQSTLSAGGGSFYLPYYWNIGGGSSSRRWLFYWGPGPGSGQKAMAVLRLQDGSGPGPGREEQTNYNIMLSHYFGPGPGSGVKTDVPIALEGCDGPGPGQATTDAATNVALQMYGPGPGRWFSVMAGPSVRVNEGPGPGVRNRWFSVMAGPSVRGPGPGKYTTTNYFEFYLPYYGPGPGDPSYFNDFDNKYGSSKKEGNGAAVYTNMKKTGNDKEMYTATYNQNFKKNVSATKLQTNGAVSGVKKKSGTADGVQPTAFANQATTDAKKSVMAGPSVRVNKKAGDKNRQLTRYSDTRWHKKPSYFNDFDNKYGSSTDGYKKHQKEAPGQGGGS.”

The multitope vaccine is built using different sequences connected by specific linkers. The adjuvant (red) and PADRE (yellow) sequences are joined at the N- and C-terminal respectively. Eight CTL epitopes are connected with GGGS linkers (Green), while 8 HTL epitopes are connected with GPGPG linkers (orange). Finally, 8 BCL epitopes are connected with KK linkers (Blue).
This construct was predicted to be nonallergenic, nontoxic, and had an antigenicity score of 1.2568 (VaxiJen).
Physicochemical features, protein solubility assessment, and secondary structure prediction
The designed vaccine construct consists of 490 amino acids, with a molecular weight of 51 523.53 Da. The theoretical isoelectric point (pI) of the vaccine is 9.79, indicating a positively charged nature under physiological conditions, which is supported by the presence of 64 positively charged residues (Arg + Lys) compared to 31 negatively charged residues (Asp + Glu). Moreover, the protein exhibits moderate stability, as indicated by its estimated half-life of approximately 1 hour in mammalian reticulocytes in vitro and more than 10 hours in Escherichia coli in vivo. The vaccine’s structural stability is further supported by a low instability index of 38.77. In addition, the protein demonstrates hydrophilic characteristics, with a negative GRAVY value of −0.629. The physicochemical properties of the predicted vaccine construct are given in the Supplemental Table S6. In addition, the vaccine is predicted to be soluble with a probability score of 0.852386 (SOLpro). The vaccine secondary structure predicted by the PESIPRED server is composed of 14.08% helix, 32.24% strand, and 46.33% coil structure. The structure is given in Supplemental Figure S4.
Tertiary structure prediction, refinement, and validation
Phyle2 and 3Dpro were used to make 3D structure predictions and then Procheck and Prosa were used to double-check those predictions. Validation showed that the model predicted by the 3Dpro server was superior to those projected by phyle2. Figure 5 shows the results of using the GalaxyRefine server, a computer software, to refine the projected 3D structure (3Dpro) of the prospective vaccine and structural validation. We used the Ramachandran plot (PROCHECK) (Figure 5B) and the ProSA web service (Figure 5C) to compare the initial and final structures. Around 92.4% of residues in the optimized structure are in the primary allowed zone, 6.0% in the supplementary permitted region, 1.0% in the generously allowed region, and 0.5% in the unfavorable region. The Z-score went up from −2.54 to −3.41 as well. The main structure included 0.8% of disallowed residues, 1.6% of residues in the generously permitted zone, 1.6% in the extra allowed region, and 84.8% of residues in the most preferred region.

The 3-dimensional structure of vaccine obtained after molecular refinements and validation by Ramachandran plot analysis and ProSA. (A) The constructed vaccine model, with adjuvants highlighted in red, CTL epitopes in green, HTL epitopes in yellow, and B-cell epitopes in blue. (B) The red, yellow, gray, and white color sections represent residues in the most favored, additional permitted, generously allowed, and disallowed regions, respectively. (C) A Z-plot of the revised vaccination model derived from the Pro-SA webserver. The Y-axis depicts the Z-score acquired by NMR or X-ray crystallography for natural proteins, while the X-axis represents the number of residues. The black dot on the Z-plot represents our vaccine’s achieved Z-score.
Conformational B-cell epitope prediction
The tertiary structure and folding of the designed vaccine may generate new conformational B-cell epitopes and for this purpose, we used ElliPro server conformational. In the current assessment, the server predicts 11 new epitopes, and their scores were between 0.532 and 0.877 which are given in the Supplemental Table S7. The predicted 3D models of the generated epitopes are shown in Supplemental Figure S5.
Vaccine disulfide engineering
Disulfide by Design 2.0 server suggested that 35 pairs of amino acids are eligible to make disulfide bonds. Mutation was created for pairs having energy values less than 2. Both LEU228-TYR231 and VAL434-ASN437 pairs were engineered to have lower energy scores and chi-3 values of −102.89 and 104.79, respectively.
Molecular docking of the vaccine with TLR-4
Molecular docking analysis using ClusPro 2.0 generated 30 docking models, with the top-ranked model (model 0.00) exhibiting the lowest binding energy of −1378.5 kcal/mol, indicating a highly stable and strong interaction between the designed multitope vaccine and human TLR-4 (Figure 6). The PDBsum server provided detailed insights into the vaccine-TLR-4 interface, highlighting significant interactions across multiple receptor chains. Among these, chain B demonstrated the most extensive binding with the vaccine, involving 30 and 32 interface residues across an interaction area of 1505 Ų and 1519 Ų, respectively. This interaction was stabilized by the formation of 2 salt bridges, 17 hydrogen bonds, and 193 nonbonded contacts, underscoring a robust molecular association (Figure 7). Chain A exhibited moderate interaction, with 7 and 6 interface residues spanning areas of 274 Ų and 292 Ų, contributing 1 salt bridge, 7 hydrogen bonds, and 60 nonbonded contacts. Chain D also displayed notable interactions, involving 9 and 15 interface residues over areas of 621 Ų and 554 Ų, with 1 salt bridge, 6 hydrogen bonds, and 76 nonbonded contacts. These findings collectively suggest that the designed vaccine establishes strong and stable interactions with TLR-4, potentially enhancing immune activation and downstream signaling.

Docked complex of vaccine constructs with human TLR-4 (A, B); vaccine constructs in magenta color and TLR-4 receptor in red and MD2 in green color.

Receptor-vaccine docking analysis. (A) Depicts the docked complex of TLR-4/MD2-vaccine, with the vaccine construct highlighted in red, where the specific interacting residues are highlighted in purple. (B) The interacting residues in the interface of the docked complex, where interacting chains are connected by colored lines, each denoting a different type of interaction as indicated in the key provided.
Dihedral coordinate-based normal-mode analyses
NMA was used on the iMODS simulation server to evaluate the stability and adaptability of the vaccine-TLR-4 complex. We first compared the vaccine-TLR-4 complex to the TLR-4 protein using deformability (Figure 8A) and B-factor (Figure 8B) analysis and found that the vaccine-TLR-4 complex had much less distortion. In comparison to the eigenvalue of the target TLR-4 protein, which was 2.480454e 05, the eigenvalue of the vaccine-TLR-4 complex was 3.0261702e 08 (Figure 8 C), showing that much less energy is required to deform the complex. In addition, the variance analysis was used to represent the stiffness of the complex (Figure 8D), and it was shown to be inversely proportional to the eigenvalue. The iMOS generated a covariance matrix showing the linked residue pairs with either anti-correlated (blue) or correlated (red) movements, or without any correlation (white). Predicted associated residue-pair movements were greater for the protein complex than for TLR-4, while uncorrelated motions were lower for the complex protein (Figure 8E). In addition, an elastic network analysis was carried out, with each spring standing in for a specific atomic pair. Analysis of the residues close to the carboxy terminus showed the dark gray band around the spring and noncontinuous gray bands around the same immobility normal string (Figure 8F).

Dihedral coordinate-based normal-mode analyses of the vaccine-hTLR-4 complex; ligand-receptor interaction was assessed throughout comparative (A) Deformabilities, (B) b-factor, (C) eigenvalues, (D) variance, (E) covariance of residue indices, and (F) elastic network analysis.
Immune simulation of the designed vaccine
Secondary immunological responses, such as IgM + IgG, IgM, IgG1 + IgG2, IgG1, and IgG2, were shown to be highly stimulated by the potential vaccine, and they increased with further doses of the vaccine (Figure 9A). There was an uptick in the production of cytokines such as interferon-gamma (IFN-γ), transforming growth factor beta (TGF-β), and interleukin-10 (IL-10) after vaccination. A significant elevation in IFN-γ levels was seen after the first vaccination, with concentrations reaching over 400 000 ng/mL. This is consistent with the activation of cellular immune responses. After the second dosage, IFN-γ levels remained stable, demonstrating a sustained induction. Interferon-γ levels were high but slightly rose after the third treatment, reaching over 450 000 ng/mL (Figure 9B). Transforming growth factor-β levels followed a distinct pattern, with a first-dose induction of about 150 000 ng/mL. As can be seen in Figure 7B, Transforming growth factor-β concentrations steadily declined throughout many administrations, from a peak of about 75 000 ng/mL after the second dosage to around 10 000 ng/mL after the third dose. After the first 2 vaccination doses, IL-10 levels peaked at approximately 50 000 ng/mL, suggesting an early immunological response. However, IL-10 concentrations dropped dramatically after the third dosage (Figure 9B), indicating that IL-10 production naturally declines with time. It was also discovered that the vaccination doses prompted a rise in the number of activated B and T cells. Figure 9C shows that the third vaccination dosage produced the largest number of B cells, whereas Figure 9D shows that the second vaccine dose produced the highest number of T cells. This suggests that both T and B cell populations expand in response to vaccination, with separate maxima occurring after different doses of the vaccine.

Anticipated immune response following the injection of the designed vaccine. Panel (A) and (B) display the number of antibodies and cytokines, respectively, in response to the vaccine. Panel (C) and (D) depict the population of B and T cells, respectively.
Molecular dynamic simulation
We performed several investigations using MD simulations based on Cα atoms, to determine the stability of the vaccine-TLR-4 complex. Protein conformational changes during ligand binding were analyzed using the RMSD. After a dramatic spike in the first 10 ns, the complex’s RMSD value stabilized at roughly 0.2 nm for the rest of the run. After reaching its peak at 30 ns, it gradually dropped over the next 20 ns. At the end of the molecular dynamic simulations, the complex settled into a rather stable form (Figure 10A). We used the RMSF to assess the protein’s local adaptability. Increases in RMSF values suggest more positional flexibility in certain amino acids. Particularly flexible were residues at positions 10, 250, and 450 (Figure 10B), indicating a possible role in interactions with the receptor. Using the Rg, we could evaluate how compact the protein was. Stable protein folding is represented by a constant Rg value, whereas changes in this value imply unfolding. Our investigation showed that after 40 ns, the Rg rapidly decreased, then increased, and then decreased again, resulting in a compact condition (Figure 10C). Solvent-accessible surface area research was used to evaluate the protein’s hydrophobic core stability. Increases in SASA reflects a higher propensity for protein instability due to solvent accessibility. The SASA values dropped steadily during the simulation and reached rock bottom at the conclusion. Figure 10D shows that this arrangement decreases the likelihood of solvent disruption and implies that the protein is more stable.

Analysis of conformational changes, flexibility, compactness, and hydrophobic core stability of the vaccine-TLR-4 complex across 100 ns explicit molecular dynamics simulation run. (A) RMSD, (B) RMSF, (C) RG, and (D) SASA. Here, RMSD, root mean square deviation; RMSF, root mean square fluctuation; RG, mean radius of gyration, and SASA meaning solvent-accessible surface area.
Codon optimization and mRNA prediction of the vaccine construct
We employed a sophisticated codon optimization strategy for the E coli K12 strain, using the JCAT tool for precision engineering of the vaccine’s coding sequence. This optimization yielded a codon sequence with a length of 1470 base pairs (bp). Significantly, the optimized sequence achieved a CAI of 0.98, surpassing the benchmark value of 0.8 and indicating a high level of expression efficiency in the target host system. Furthermore, the GC content of the optimized sequence was measured at 51.22%, aligning closely with the native GC content of the E coli K12 strain (50.73%), an essential factor for ensuring transcriptional and translational fidelity.
Advancing the molecular architecture of the vaccine, we leveraged the RNAfold server to predict the mRNA secondary structure of our vaccine construct (Figure 11). This critical step, informed by our codon-optimized sequence, allowed for a rigorous assessment of the mRNA’s structural integrity. The server’s analysis predicted a highly stable mRNA structure characterized by substantial base pairing and a marked absence of unstable regions, underpinning the vaccine’s potential efficacy. Notably, the minimum free energy (MFE) of the optimal secondary structure was calculated to be −475.90 kcal/mol, with the secondary centroid structure exhibiting a free energy of −369.28 kcal/mol. Furthermore, the ensemble free energy was determined to be −503.05 kcal/mol, underscoring the vaccine mRNA’s robust stabilization across a spectrum of potential structural conformations.

Optimizing codons and predicting mRNA vaccine structure. (A) Optimal secondary structure, (B) Centroid secondary structure of the vaccine mRNA retrieved using RNAfold Webserver. (C) CAI value, (D) a dot plot containing the base pair probabilities, (E) a mountain plot representation of the MFE structure, the thermodynamic ensemble of RNA structures, and the centroid structure along with the positional entropy for each position.
Discussion
Millions of children under the age of 5 are disproportionately affected by shigellosis, a severe diarrhea illness caused by the gram-negative bacteria Shigella. 16 Long-term effects include things like stunted development 76 (in children), mental retardation 77 (in adults), and reactive arthritis 5 (in children). Despite its widespread impact, the development of effective vaccines for shigellosis has been elusive, and current treatment options are limited. 78 While some promising vaccine candidates are in trials,27,79 the absence of a licensed vaccine persists. Therefore, the purpose of this research was to develop an efficient epitope-based vaccination against prevalent Shigella pathotypes using a reverse vaccinology strategy to overcome these obstacles.
The computational approach of reverse vaccinology was used to find possible vaccine candidates. 80 In this research, vaccine candidates were derived from the proteome of S. sonnei str. Ss046, the type strain of S. sonnei. Putative outer membrane protein (Q3YZL0), PapC-like porin protein (Q3YZM5), Putative fimbrial-like protein (Q3Z3I2), and LPS-assembly protein LptD (Q3Z5V5) were chosen because they met all of the necessary criteria, such as virulence, lack of homology to human proteins, antigenicity, and conservation among different Shigella strains. The putative outer membrane protein of S. sonnei has yet to be fully characterized, although it is thought to be involved in important bacterial processes including adhesion and invasion. 81 Porin-mediated food absorption, transporter function, and the development of extracellular encapsulating structures are probably all aided by the PapC-like porin protein. 82 Possible fimbrial-like proteins contribute to adhesion, biofilm formation, and bacterial colonization through fimbriae-mediated adhesion. 83 Lipopolysaccharide production and transport rely on the LPS-assembly protein LptD. 84
Our in-silico approach integrated multiple computational methods to predict T-cell and B-cell epitopes, ensuring their immunogenicity, stability, and broad population coverage. The successful generation of high-confidence 3D models for all target proteins highlights their structural reliability and suitability for epitope mapping. Validation metrics, including Ramachandran plot analysis and GMQE scores, confirmed the model’s accuracy. Mapping of CTL, HTL, and B-cell epitopes onto these structures revealed their surface-exposed and solvent-accessible locations, critical features for effective immune recognition and antigenicity. 85 The distribution of epitopes across extracellular loops and functional domains, as observed in the putative outer membrane protein (Q3YZL0) and LPS-assembly protein LptD (Q3Z5V5), emphasizes their immunological relevance. Similarly, the positioning of epitopes near porin channel openings in PapC-like porin protein (Q3YZM5) and across functional domains in the putative fimbrial-like protein (Q3Z3I2) underscores their potential for eliciting robust immune responses.
The designed vaccine construct demonstrated favorable physicochemical properties, including solubility, stability, non-allergenicity, and non-toxicity. After 3 vaccinations, the body produced abundant quantities of antibodies (IgM + IgG, IgG1 + IgG2) and cytokines (IFN-γ, TGF-β, IL-10). These predicted responses align with known protective immune mechanisms observed in Shigella infections, where humoral immunity, particularly IgG responses, plays a crucial role in pathogen clearance, 86 and IFN-γ-mediated cellular immunity is essential for controlling intracellular bacterial replication. 87 The presence of regulatory cytokines such as TGF-β and IL-10 further suggests a balanced immune response, which is critical for mitigating excessive inflammation while ensuring effective pathogen elimination. 88 Notably, the molecular docking analysis revealed significant binding affinities between epitopes and HLA alleles, further validating the vaccine’s potential to elicit both humoral and cellular immunity, which is consistent with previous findings.89,90 Moreover, TLR-4 an important receptor for innate immunity and adjuvant action, showed high affinity and stability with the vaccination.
Comparing this approach to other in silico-designed peptide vaccines, such as those targeting Salmonella, Escherichia coli, and Klebsiella pneumoniae, our vaccine design methodology demonstrates superior antigen selection by focusing on highly conserved proteins involved in key bacterial processes.31,91,92 Unlike traditional peptide vaccine designs that rely on empirical screening, our strategy integrates structural modeling, normal mode analysis, and MD simulations to refine the vaccine construct. Structural validation analyses, including the Ramachandran plot and the ProSA web service, were conducted to evaluate the stability and quality of the vaccine construct. The optimized structure showed 92.4% of residues in the primary allowed region, 6.0% in the supplementary permitted region, 1.0% in the generously allowed region, and 0.5% in the forbidden region. The Z-score improved from −2.54 to −3.41, indicating enhanced structural reliability. These findings are consistent with previous studies on similar vaccine constructs, reinforcing the structural integrity and potential effectiveness of the designed vaccine.93,94 The vaccine’s structure remained resilient, demonstrated by its low deformability and high stiffness in normal mode analysis. The vaccine-TLR-4 complex was modeled using MD, and the results shed light on the stability and dynamics of this complex. Changes in the RMSD value suggested structural changes in the protein in response to ligand interaction. Particular amino acids surrounding the 10th, 250th, and 450th residues have been singled out as being potentially important in receptor interactions because of their proximity to extremely flexible areas. The protein’s folding and unfolding behavior, as well as the subsequent transition to a compact form, were also revealed by the examination of the Rg. This result indicates that the compound has a stable structural conformation. With decreasing SASA values, the probability of solvent-induced protein instability has been shown to diminish, as measured by the SASA study. Identification of key flexible regions provides potential targets for site-directed mutagenesis studies, in which specific amino acids are modified to improve vaccine efficacy, stability, or binding affinity to the receptor. 95
A key innovation of this study is the development of an mRNA-based vaccine, which offers significant advantages over conventional DNA-based MEVs that require plasmid construction and cloning. 96 The mRNA vaccine design leveraged the RNAfold server and related algorithms to optimize secondary structure stability and free energy profiles. The codon optimization process tailored the mRNA sequence for optimal expression in E. coli K12, yielding a CAI value of 0.98, indicating efficient translation potential. The predicted secondary structure revealed substantial base pairing and minimal unstable regions, suggesting enhanced stability and translational efficiency. 97
Overall, the results of this work highlight the promise of reverse vaccinology for developing mRNA Shigella vaccines based on epitopes. The proposed vaccine shows potential for providing widespread protection against Shigella infection by targeting conserved antigens engaged in essential activities for bacterial survival and pathogenesis. Importantly, it overcomes the safety issues, antigenic diversity, serotype specificity, and inadequate immunogenicity of traditional vaccinations, hence solving the challenge of broad-spectrum protection. 29 Despite the positive findings, it is important to note the study’s limitations. Additional research is needed to characterize the proteins’ functions, especially the Putative outer membrane protein. The vaccine’s efficacy was also evaluated computationally; more experimental validation and clinical studies are needed to verify the vaccine’s efficacy and safety in practice. To overcome these obstacles, researchers need to undertake in vitro and in vivo experiments to confirm the vaccine’s immunogenicity, protective effectiveness, and safety. The vaccine design process might be improved by investigating new bioinformatics techniques, using omics data, and taking into account a variety of Shigella strains.
In summary, our research offers a potential reverse vaccinology mRNA vaccine based on multiple epitopes that can be used to protect against the most frequent Shigella pathotypes. The findings provide credence to the vaccine’s promise of widespread protection, help researchers find ways to work around its current limits, and forward the research into vaccines for shigellosis and other infectious illnesses. Further study and experimental validation of this vaccine design technique are required before it can be used in clinical practice.
Conclusion
The goal of this research was to create an mRNA vaccine against the most prevalent Shigella pathotypes that cause shigellosis. It is found all across the world, but no reliable vaccination has yet been developed to prevent it. We set out on an untried strategy for developing vaccines using computational methods. By analyzing 4 essential proteins found in most of the Shigella strains and essential to their survival, we were able to locate immunogenic regions that may trigger an immune response. Together, these pieces form a composite vaccination with added ingredients for increased potency. Vaccine properties and structure were analyzed computationally, as was the vaccine’s interaction with TLR-4, a key protein in immune recognition. Remarkably, our results highlighted long-lasting compatibility between the vaccination and hTLR-4. Using state-of-the-art computer models, we were able to predict the vaccine’s ability to provoke a strong immunological response, one that includes antibodies, cytokines, and activated B and T cells. All of these positive results point to the vaccine’s potential to prevent Shigella infections. Based on our findings, this vaccine seems to be a strong contender that should undergo more testing in the real world.
Supplemental Material
sj-docx-1-bbi-10.1177_11779322251328302 – Supplemental material for Development of a Novel mRNA Vaccine Against Shigella Pathotypes Causing Widespread Shigellosis Endemic: An In-Silico Immunoinformatic Approach
Supplemental material, sj-docx-1-bbi-10.1177_11779322251328302 for Development of a Novel mRNA Vaccine Against Shigella Pathotypes Causing Widespread Shigellosis Endemic: An In-Silico Immunoinformatic Approach by Abdur Razzak, Otun Saha, Khandokar Fahmida Sultana, Mohammad Ruhul Amin, Abdullah bin Zahid, Afroza Sultana, Uditi Paul Bristi, Sultana Rajia, Nikkon Sarker, Md Mizanur Rahaman, Newaz Mohammed Bahadur and Foysal Hossen in Bioinformatics and Biology Insights
Footnotes
References
Supplementary Material
Please find the following supplemental material available below.
For Open Access articles published under a Creative Commons License, all supplemental material carries the same license as the article it is associated with.
For non-Open Access articles published, all supplemental material carries a non-exclusive license, and permission requests for re-use of supplemental material or any part of supplemental material shall be sent directly to the copyright owner as specified in the copyright notice associated with the article.
